Protein coding transcript 149069

• Transcript: Ll_transcript_28641
• CDS coordinates: 3138-3647 (+)
• Peptide sequence: MKPVCPFVKAARPDDNTCKRSGENSVKHQVEPENKLKKEVSNSASTSPKCPFGYDSQTFKIGPLSCMVCQALLFESSKCVPCSHVFCKACISRFSDCPLCGADIVKIEPDAELQGVVDRFIEGHARIKRSANSGKQEEETESKPVIYEDVSLERGSFLVQQAMRVSMDF*
• ORF Type: complete

Annotations of Ll_transcript_28641

• Blastp: Protein NCA1 from Arabidopsis with 59.78% of identity
• Blastx: Protein NCA1 from Arabidopsis with 59.78% of identity
• Eggnog: RING(ENOG411005M)
• Kegg: Link to kegg annotations (AT3G54360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437053.1)
• Pfam: RING-type zinc-finger (PF13445.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;