Protein coding transcript 149106

• Transcript: Ll_transcript_29713
• CDS coordinates: 836-1240 (+)
• Peptide sequence: MFFPGGFLKLSGEIYEHAVVLSVKTEDQDAFERDFFQLKPYYTDASNRLPPSPQEYPILGLNLLRLLVQNRIAEFHTELELLSPTALENPCINHAVELEQSFMEGAYNRVLSARQTVPHDTYVYFMDLLAKTVR*
• ORF Type: complete

Annotations of Ll_transcript_29713

• Blastp: 26S proteasome non-ATPase regulatory subunit 8 homolog A from Arabidopsis with 84.25% of identity
• Blastx: 26S proteasome non-ATPase regulatory subunit 8 homolog A from Arabidopsis with 84.25% of identity
• Eggnog: 26S proteasome nonATPase regulatory subunit(ENOG410XXP2)
• Kegg: Link to kegg annotations (AT1G64520)
• CantataDB: Link to cantataDB annotations (CNT0000914)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464492.1)
• Pfam: CSN8/PSMD8/EIF3K family (PF10075.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;