Transcript | Ll_transcript_29721 |
---|---|
CDS coordinates | 75-629 (+) |
Peptide sequence | MDPKLTEVSQIFNRFKAAFVRNDYDNCSNLLSQLKVLLTGFRSLPPLFEDTPNAVHELTIAREIYEHAVVLSVKTEDQDAFERDFFQLKPYYTDASNRLPPSPQEYPILGLNLLRLLVQNRIAEFHTELELLSPTALENPCINHAVELEQSFMEGAYNRVLSARQTVPHDTYVYFMDLLAKTVR* |
ORF Type | complete |
Blastp | 26S proteasome non-ATPase regulatory subunit 8 homolog A from Arabidopsis with 83.7% of identity |
---|---|
Blastx | 26S proteasome non-ATPase regulatory subunit 8 homolog A from Arabidopsis with 83.7% of identity |
Eggnog | 26S proteasome nonATPase regulatory subunit(ENOG410XXP2) |
Kegg | Link to kegg annotations (AT1G64520) |
CantataDB | Link to cantataDB annotations (CNT0000914) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464492.1) |
Pfam | CSN8/PSMD8/EIF3K family (PF10075.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer