Protein coding transcript 14914

• Transcript: Ll_transcript_426498
• CDS coordinates: 1526-1990 (+)
• Peptide sequence: MHKAGKSSKGYGFDVNNTIGSTPQINTWSSDWIQFYGECRLGYQLKLALDQYGDKTIYEKGQRLVKSMGPLFDNVVIEPCLLHGDLWSGNISSDKNGEPVILDPACYYGHSEAEFGMSWCAGFGGSFYNSYFEACSSYLSLFRISFLFLLFVSN*
• ORF Type: complete

Annotations of Ll_transcript_426498

• Blastp: Protein-ribulosamine 3-kinase, chloroplastic from Arabidopsis with 73.51% of identity
• Blastx: Protein-ribulosamine 3-kinase, chloroplastic from Arabidopsis with 69.63% of identity
• Eggnog: Fructosamine(COG3001)
• Kegg: Link to kegg annotations (AT3G61080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461137.1)
• Pfam: Fructosamine kinase (PF03881.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;