| Transcript | Ll_transcript_426501 |
|---|---|
| CDS coordinates | 304-630 (+) |
| Peptide sequence | MAVASMSVSQDPVREWILSEGQATKITKISPVGGGCINLASRYDTDAGSFFVKTNRYVYVITHSNFCSGLMIELSFTFGVETGKFHVECIGLFRLSLSKSFIPSASYI* |
| ORF Type | complete |
| Blastp | Protein-ribulosamine 3-kinase, chloroplastic from Arabidopsis with 73.21% of identity |
|---|---|
| Blastx | Protein-ribulosamine 3-kinase, chloroplastic from Arabidopsis with 53.25% of identity |
| Eggnog | Fructosamine(COG3001) |
| Kegg | Link to kegg annotations (AT3G61080) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019461137.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer