Protein coding transcript 149196

• Transcript: Ll_transcript_28779
• CDS coordinates: 2-355 (+)
• Peptide sequence: AKWEPSVDGYLKFLVDSKLVYDTLEKIVEEPAYPSFTIVVNVAVCDCGHCGRSDVECRRCSVNCFVIKILFLNLMRYGPNVVQMLLHCGLTRLRCGPMRLHHCDSESYRNCSVMRLW*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_28779

• Blastp: Heme oxygenase 1, chloroplastic from Arabidopsis with 56.82% of identity
• Blastx: Heme oxygenase 1, chloroplastic from Arabidopsis with 56.82% of identity
• Eggnog: Heme oxygenase(COG5398)
• Kegg: Link to kegg annotations (AT2G26670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437504.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;