Protein coding transcript 149199

• Transcript: Ll_transcript_28784
• CDS coordinates: 38-589 (+)
• Peptide sequence: MKDKQALQQSSQVYHISIKLSQSSLKLPHKSTIPSLFAFFSNLPQLQMTMKKVVLKVELYDDRIQTKAMQAVSGISGVESLSLDKKDSKFTLIGDIDPVKVVRKLKKLCHVEIVFVGPAKEEKKEEPKKEEKKPEQKPKDEKEQLIELVKAHEAYYNQMRMTQSYPCYYYRTVEEDPNGCVIC*
• ORF Type: complete

Annotations of Ll_transcript_28784

• Blastp: Heavy metal-associated isoprenylated plant protein 12 from Arabidopsis with 36.36% of identity
• Blastx: Heavy metal-associated isoprenylated plant protein 39 from Arabidopsis with 50.7% of identity
• Eggnog: Heavy-metal-associated domain(ENOG4111AW0)
• Kegg: Link to kegg annotations (AT5G52740)
• CantataDB: Link to cantataDB annotations (CNT0001149)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451570.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;