Protein coding transcript 149200

• Transcript: Ll_transcript_28788
• CDS coordinates: 696-1019 (+)
• Peptide sequence: MLIFSGVESLSVDKNDKKFTLIGDIDPVQVVRKLKKLCHVEIVSVGPAKEEKKEEPKIEDKKKDEKEIIAEILKTHEAYYYHMRMAQSYPYYCYKTVEEDHSGCVIC*
• ORF Type: complete

Annotations of Ll_transcript_28788

• Blastp: Heavy metal-associated isoprenylated plant protein 14 from Arabidopsis with 40.19% of identity
• Blastx: Heavy metal-associated isoprenylated plant protein 39 from Arabidopsis with 45.45% of identity
• Eggnog: Heavy-metal-associated domain(ENOG4111AW0)
• Kegg: Link to kegg annotations (AT5G52760)
• CantataDB: Link to cantataDB annotations (CNT0001149)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450121.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;