Protein coding transcript 149213

• Transcript: Ll_transcript_29072
• CDS coordinates: 371-955 (+)
• Peptide sequence: MFSDFIKGERILPSILKFICCKLQIKCLRCTGKSERYERIMDLTVEIDGDIGTLEEALGQFTAPETLDIDNKYNCSRCKSSEKARKKLTILEAPNILTIVLKRFQPGNYKKLVQFPEVLNMSPYMSGTKDKSPLYSLYAVVVHLDTMAAAFSGHYVCYVKNMQGEWFKIDDSRVEPVELSTVLSERAYMLLYAR*
• ORF Type: complete

Annotations of Ll_transcript_29072

• Blastp: Ubiquitin carboxyl-terminal hydrolase 17 from Arabidopsis with 66.86% of identity
• Blastx: Ubiquitin carboxyl-terminal hydrolase 17 from Arabidopsis with 66.86% of identity
• Eggnog: ubiquitin carboxyl-terminal hydrolase(ENOG410XQ92)
• Kegg: Link to kegg annotations (AT5G65450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445403.1)
• Pfam: Ubiquitin carboxyl-terminal hydrolase (PF13423.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;