Protein coding transcript 149217

• Transcript: Ll_transcript_29061
• CDS coordinates: 243-854 (+)
• Peptide sequence: MQSICLKNAGRLSPLAEETTLVRYTFGGYLRSKIKCLRCTGKSERYERIMDLTVEIDGDIGTLEEALGQFTAPETLDIDNKYNCSRCKSSEKARKKLTILEAPNILTIVLKRFQPGNYKKLVQFPEVLNMSPYMSGTKDKSPLYSLYAVVVHLDTMAAAFSGHYVCYVKNMQGEWFKIDDSRVEPVELSTVLSERAYMLLYAR*
• ORF Type: complete

Annotations of Ll_transcript_29061

• Blastp: Ubiquitin carboxyl-terminal hydrolase 17 from Arabidopsis with 67.15% of identity
• Blastx: Ubiquitin carboxyl-terminal hydrolase 17 from Arabidopsis with 67.67% of identity
• Eggnog: ubiquitin carboxyl-terminal hydrolase(ENOG410XQ92)
• Kegg: Link to kegg annotations (AT5G65450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445403.1)
• Pfam: Ubiquitin carboxyl-terminal hydrolase (PF00443.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;