Transcript | Ll_transcript_426488 |
---|---|
CDS coordinates | 1435-1899 (+) |
Peptide sequence | MHKAGKSSKGYGFDVNNTIGSTPQINTWSSDWIQFYGECRLGYQLKLALDQYGDKTIYEKGQRLVKSMGPLFDNVVIEPCLLHGDLWSGNISSDKNGEPVILDPACYYGHSEAEFGMSWCAGFGGSFYNSYFEACSSYLSLFRISFLFLLFVSN* |
ORF Type | complete |
Blastp | Protein-ribulosamine 3-kinase, chloroplastic from Arabidopsis with 73.51% of identity |
---|---|
Blastx | Protein-ribulosamine 3-kinase, chloroplastic from Arabidopsis with 69.63% of identity |
Eggnog | Fructosamine(COG3001) |
Kegg | Link to kegg annotations (AT3G61080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017442285.1) |
Pfam | Fructosamine kinase (PF03881.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer