Protein coding transcript 149241

• Transcript: Ll_transcript_29760
• CDS coordinates: 91-1047 (+)
• Peptide sequence: MVGRSSFGDRKGVRIAVVGDGGTGKSTLIAAMASESFPDSVPPVLPPTRLPHNLYPDSVPLTLIDTPSSLEKQGTRNEELKIADAVVVTYACDEPVTFDRLGTYWLVELQRLEVKAPVVVVGCKMDLRDEDQVVSLESLTSYLMQQFTEIVTCVECSAATLYQVPEVFYFAQKAVLHPVGPLFDYERHTFTDRCLRALRRIFVLCDHDMDGTLNDEELNEFQVKCFNEGLQPTEVARVKALVDQNVPEGVNSLGLTFPGFTYVHNIFLKKGRTETFWAVLRKFGYDNDLKLRDDFLPVPSKQASDQVILIFFNFAVVK*
• ORF Type: complete

Annotations of Ll_transcript_29760

• Blastp: Mitochondrial Rho GTPase 2 from Arabidopsis with 56.86% of identity
• Blastx: Mitochondrial Rho GTPase 2 from Arabidopsis with 56.86% of identity
• Eggnog: Mitochondrial GTPase involved in mitochondrial trafficking (By similarity)(ENOG410XRHW)
• Kegg: Link to kegg annotations (AT3G63150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441846.1)
• Pfam: 50S ribosome-binding GTPase (PF01926.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;