Transcript | Ll_transcript_29517 |
---|---|
CDS coordinates | 566-1180 (-) |
Peptide sequence | MILGNLIAITQTSMKRMLAYSSIGQIGYVIIGIIVGDSNGGYASMITYMLFYISMNLGTFACIVSFGLRTGTDNIRDYAGLYTKDPFLALSLALCLLSLGGLPPLAGFFGKLHLFWCGWQAGLYFLVSIGLLTSVVSIYYYLKIIKLLMTGRNQEITPHVRNYRRSPLRSNNSIELSMIVCVIASTIPGISMNPIIEIAQDTLF* |
ORF Type | complete |
Blastp | NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic from Phaseolus with 98.53% of identity |
---|---|
Blastx | NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic from Morus with 98.8% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (PhvuCp103) |
CantataDB | Link to cantataDB annotations (CNT0002482) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (YP_009141761.1) |
Pfam | Proton-conducting membrane transporter (PF00361.19) |
Rfam | Intron_gpII (RF00029) |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer