Protein coding transcript 149352

• Transcript: Ll_transcript_29508
• CDS coordinates: 313-927 (+)
• Peptide sequence: MILGNLIAITQTSMKRMLAYSSIGQIGYVIIGIIVGDSNGGYASMITYMLFYISMNLGTFACIVLFGLRTGTDNIRDYAGLYTKDPFLALSLALCLLSLGGLPPLAGFFGKLHLFWCGWQAGLYFLVSIGLLTSVVSIYYYLKIIKLLMTGRNQEITPHVRNYRRSPLRSNNSIELSMIVCVIASTILGISMNPIIEIAQDTLF*
• ORF Type: complete

Annotations of Ll_transcript_29508

• Blastp: NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic from Gossypium with 99.02% of identity
• Blastx: NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic from Gossypium with 98.41% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (3989173)
• CantataDB: Link to cantataDB annotations (CNT0002482)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (YP_009141761.1)
• Pfam: Proton-conducting membrane transporter (PF00361.19)
• Rfam: Intron_gpII (RF00029)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;