Transcript | Ll_transcript_425668 |
---|---|
CDS coordinates | 1-792 (+) |
Peptide sequence | RLYQDKYKAKQNGQVGFAANSDFFFPKDPTNNDDVKAAQRWQQFNLGWFTHPIFSKAGDYPQEMKEYIDAASQKQGLARSRLPVFTAEEIKMIQGSADFCGINSYTSALVAQLKSSDPQPKTRTRTSDAAVVVSRDPNWETTIAPWHFVVPTGIRGLVNWLRTEYDNPRVIVTENGYPDSGQMKDVGRVRYYRLYILELLKAINEDGCNVFGYTAWSLMDNYEWFYGYAHKFGLYHVDFENPDRPRTPKMSAKFYQRLVSTGKV |
ORF Type | internal |
Blastp | Myrosinase 1 from Brevicoryne with 44.7% of identity |
---|---|
Blastx | Myrosinase 1 from Brevicoryne with 44.7% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004490145.2) |
Pfam | Glycosyl hydrolase family 1 (PF00232.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer