Protein coding transcript 1494

• Transcript: Ll_transcript_425668
• CDS coordinates: 1-792 (+)
• Peptide sequence: RLYQDKYKAKQNGQVGFAANSDFFFPKDPTNNDDVKAAQRWQQFNLGWFTHPIFSKAGDYPQEMKEYIDAASQKQGLARSRLPVFTAEEIKMIQGSADFCGINSYTSALVAQLKSSDPQPKTRTRTSDAAVVVSRDPNWETTIAPWHFVVPTGIRGLVNWLRTEYDNPRVIVTENGYPDSGQMKDVGRVRYYRLYILELLKAINEDGCNVFGYTAWSLMDNYEWFYGYAHKFGLYHVDFENPDRPRTPKMSAKFYQRLVSTGKV
• ORF Type: internal

Annotations of Ll_transcript_425668

• Blastp: Myrosinase 1 from Brevicoryne with 44.7% of identity
• Blastx: Myrosinase 1 from Brevicoryne with 44.7% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004490145.2)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;