Protein coding transcript 149445

• Transcript: Ll_transcript_28744
• CDS coordinates: 3-356 (+)
• Peptide sequence: RVRKLQYISELERSVTSLQAEVSLLSPRVAFLDHQRLLLTVDNSALKQRIAALGQDKIFKDAHQEALKREIERLRQVYHQQNLKNMENAAGSPSPSPSPKPRFDAQTEKEQLQPLNV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_28744

• Blastp: Basic leucine zipper 61 from Arabidopsis with 79.49% of identity
• Blastx: Basic leucine zipper 34 from Arabidopsis with 75.21% of identity
• Eggnog: Transcription factor(ENOG410YEVN)
• Kegg: Link to kegg annotations (AT3G58120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424922.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;