Protein coding transcript 149519

• Transcript: Ll_transcript_28828
• CDS coordinates: 525-974 (+)
• Peptide sequence: MTTNLDSTYHLCQLAYSLLKASGNGSIVFISSVAGVTHVGSGSIYSITKAAINQLTRNLACEWAKDNIRSNAVAPWYTKTPLVETLLAKKEFVDEVLSRTPIKRIAEVHEVSSLVAFLCLPAASYITGQIISVDGGFTVNGFQPTMRLS*
• ORF Type: complete

Annotations of Ll_transcript_28828

• Blastp: Tropinone reductase homolog At5g06060 from Arabidopsis with 74.15% of identity
• Blastx: Tropinone reductase homolog At5g06060 from Arabidopsis with 72.89% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (AT5G06060)
• CantataDB: Link to cantataDB annotations (CNT0000276)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439451.1)
• Pfam: Enoyl-(Acyl carrier protein) reductase (PF13561.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;