Transcript | Ll_transcript_29163 |
---|---|
CDS coordinates | 3-323 (+) |
Peptide sequence | GLEFLQFAFRWFNCLLIREIPFNLVTRLWDTYLAEVDALPDFLVYIFASFLLTWSNMILKLDFQELVMFLQHLPTQNWTEQELEMVLSRAFMWHSMFNSSPNHLST* |
ORF Type | 5prime_partial |
Blastp | GTPase-activating protein gyp1 from Schizosaccharomyces with 44.76% of identity |
---|---|
Blastx | GTPase-activating protein gyp1 from Schizosaccharomyces with 44.76% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPBC530.01) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448247.1) |
Pfam | Rab-GTPase-TBC domain (PF00566.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer