| Transcript | Ll_transcript_29163 |
|---|---|
| CDS coordinates | 3-323 (+) |
| Peptide sequence | GLEFLQFAFRWFNCLLIREIPFNLVTRLWDTYLAEVDALPDFLVYIFASFLLTWSNMILKLDFQELVMFLQHLPTQNWTEQELEMVLSRAFMWHSMFNSSPNHLST* |
| ORF Type | 5prime_partial |
| Blastp | GTPase-activating protein gyp1 from Schizosaccharomyces with 44.76% of identity |
|---|---|
| Blastx | GTPase-activating protein gyp1 from Schizosaccharomyces with 44.76% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPBC530.01) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019448247.1) |
| Pfam | Rab-GTPase-TBC domain (PF00566.17) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer