Protein coding transcript 149636

• Transcript: Ll_transcript_29185
• CDS coordinates: 758-1279 (+)
• Peptide sequence: MILNSQQMSPNFMLWLVLGVFLMATMLRMYATFQQLQAQAQAHAATANGLLGHTELRLHMPPSIALTSRGRLQGLRLQLALLDREFDDLDYETLRALDSDNVSSGSSMTEEEINALPVHKYKGSGPQSSSSSMQQASSSTSAEKKQDHSNATGSMKVSDDELTCSVCLEQVNVG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_29185

• Blastp: E3 ubiquitin-protein ligase SDIR1 from Arabidopsis with 75.86% of identity
• Blastx: E3 ubiquitin-protein ligase SDIR1 from Arabidopsis with 76.24% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT3G55530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439459.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;