Protein coding transcript 149660

• Transcript: Ll_transcript_29324
• CDS coordinates: 1-807 (-)
• Peptide sequence: ELALKLSKRVKLKNHDRPNAVLDLLRNYGFSKTQLSIFIKRLPKVLVAEPDKTLLPKLKFFDSIGVSTTDLPKILIGNASLLTIGLKNNIIPRYKVIRSLVRSDEEVVSTLKHGPRYFHGYEVINDSVQNIEVLRQLGSPQSSISLLVTNFPSVVFMKHSRFNEAAEATKEMGFDPLKTNFVLALQVLAKMDKATWEAKLEAFQKWGWSRDICLVAFKKYPQYIIIGEKKMMKMLSFLVDNMGCSIEEIARCPWILNRNLEKTFIPRCA
• ORF Type: internal

Annotations of Ll_transcript_29324

• Blastp: Transcription termination factor MTERF6, chloroplastic/mitochondrial from Arabidopsis with 21.51% of identity
• Blastx: Transcription termination factor MTERF6, chloroplastic/mitochondrial from Arabidopsis with 21.51% of identity
• Eggnog: mitochondrial transcription termination(ENOG410XT49)
• Kegg: Link to kegg annotations (AT4G38160)
• CantataDB: Link to cantataDB annotations (CNT0001406)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439950.1)
• Pfam: mTERF (PF02536.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;