Protein coding transcript 149672

• Transcript: Ll_transcript_29298
• CDS coordinates: 285-815 (+)
• Peptide sequence: MFFLHNSSFCSIPPSNIPFIFNNSLKQRNLFLHQQPFPSLFHRKPKASTFKIFSAGFFDGIAEIAHNKVLIAATASMLIGQISKPFTSVFLYGKEFDVKTFFQAGGFPSSHSSATVAAATFLGLERGFSDPIFGLTVVYAGLIMYDAQGVRREVGIHGRTLNKLILLQVHLNSLQSK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_29298

• Blastp: Uncharacterized membrane protein YuiD from Bacillus with 33.33% of identity
• Blastx: Uncharacterized membrane protein YuiD from Bacillus with 33.33% of identity
• Eggnog: Acid phosphatase vanadium-dependent haloperoxidase related(COG1963)
• Kegg: Link to kegg annotations (BSU32060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431248.1)
• Pfam: Divergent PAP2 family (PF02681.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;