Protein coding transcript 149685

• Transcript: Ll_transcript_28267
• CDS coordinates: 369-1487 (+)
• Peptide sequence: MMDDAYKKSRKSNHESESQDFMVNKGKGVSLSSQRPLKKIHSPERNQNQFSLQQPPPPSSRIVFPFALEGSQAQPPMQFSHQYGTSIFSPFPPPLLHPTQQFQQQQQMISFGSHYNIGYPQQHQQLQYWSDALNLSPRGRPVLRPQLQHLSPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFNTAEDAAMAYDREAFKLRGENARLNFPERFLNNVKSPSTTKSASPETSICAVSQPHDGSTSKQLEPIQEEALKVNTESVPSLAPISEENADNDSIVTEEVQVAGEGISESQELVWGDMAAWFNAGWDPHSPVWDDFDSNNNLLLHSQFPFANPNQQEFNDLDAAERQEYNTGTGSSSSSSSMMPFFW*
• ORF Type: complete

Annotations of Ll_transcript_28267

• Blastp: Ethylene-responsive transcription factor ERF054 from Arabidopsis with 41.3% of identity
• Blastx: Ethylene-responsive transcription factor ERF054 from Arabidopsis with 40.31% of identity
• Eggnog: Transcription factor(ENOG410YGYW)
• Kegg: Link to kegg annotations (AT4G28140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450081.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;