Protein coding transcript 149702

• Transcript: Ll_transcript_29586
• CDS coordinates: 3-344 (+)
• Peptide sequence: YERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKERCNIAAVVAEVDRILRPEGKLIVRDTVEIVEELESMVKAMKWEVRMTFSQDKEGILCVQKSMWRPEESETLKYAIV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_29586

• Blastp: Probable methyltransferase PMT26 from Arabidopsis with 79.46% of identity
• Blastx: Probable methyltransferase PMT26 from Arabidopsis with 79.46% of identity
• Eggnog: Methyltransferase(ENOG410Y2C5)
• Kegg: Link to kegg annotations (AT5G64030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417017.1)
• Pfam: Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;