Protein coding transcript 149730

• Transcript: Ll_transcript_232029
• CDS coordinates: 146-832 (+)
• Peptide sequence: MTTAARPTWAPAKGGNEQGGARIFGPSQKYSSRDIASHTTLKPRKEGQDTNEELKRRNLRDELEDRERRHFLTKNKSYNDDRDHVKGSHLLLEGSRRDIEDRIVARNVDADDSDVEVKSDDESDDDDSDDDDTEALLAELEQIKKERAEEKMRKERQEQEEELKVKEAELLKGNPLLNNPTSFNVKRRWDDDVVFKNQARGENKVAKRFINDTIRNDFHRKFLHRYMK*
• ORF Type: complete

Annotations of Ll_transcript_232029

• Blastp: Protein CWC15 homolog A from Xenopus with 48.95% of identity
• Blastx: Pre-mRNA-splicing factor cwc15 from Aspergillus with 66.67% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (414727)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446099.1)
• Pfam: Cwf15/Cwc15 cell cycle control protein (PF04889.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;