Protein coding transcript 149771

• Transcript: Ll_transcript_230931
• CDS coordinates: 3-1142 (+)
• Peptide sequence: DDELESETNILVDEVKALADSRSRGTVICTEVLQDDMAASLDTEEKSKGGKFSDPRQQQDLKGISKTGEKNRTKDDKTITLQILQQHFAGSLKDAAKNIGVCTTTLKRICRRHGIKRWPSRKIKKVGHSLQKLQLVIDSVQGASGVCQIDSFYSNFPDLLSPDLSGTAMLSALKQSDNTNSLSPEDFLKSPSSSCNQSSISSHPCSTMSEQQYHTTSVVEGNKDSLVVEDYANIALKRIRNEAELKSLVSQDNKEKFLPISLSQETLGEQQHSKANGNATKKEDSYRVKLTYGDEKSRFRMPKTWSYENLLQDIGMRFNIRNMSKFDVKYLDDDFEWVLLTCDADLEECIDVCQTSENRTIKLALQVSNLGMRSSLQFT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_230931

• Blastp: Protein NLP2 from Arabidopsis with 47.8% of identity
• Blastx: Protein NLP2 from Arabidopsis with 48.43% of identity
• Eggnog: RWP-RK domain-containing protein(ENOG41129QX)
• Kegg: Link to kegg annotations (AT4G35270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438098.1)
• Pfam: RWP-RK domain (PF02042.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;