Protein coding transcript 149780

• Transcript: Ll_transcript_231080
• CDS coordinates: 738-1592 (+)
• Peptide sequence: MLPCTPYVTLCSVCFLFFRLLGKVALVTGGGSGIGESITRLFHIHGAKVCIADLQDNLAKQLSESLGGEANVSFYHCDVTSEDDVRGAVDFAVEKYGTLDIIVNNAGTFGSICPDIRDASLSEFDKVFSINVKGVFNGMKHAARIMIPKKKGSIITIASIASTTGGIGMHPYTGSKHAVVGLTKSVAAELGKHGIRANCVSPYAILTALTLANLPEALRYGDVAAGFRNFMRANANLQGVELTTDDVANAVLFLASDESRYISGDNLMVDGGFTNVNHSLGVFR*
• ORF Type: complete

Annotations of Ll_transcript_231080

• Blastp: Xanthoxin dehydrogenase from Arabidopsis with 67.29% of identity
• Blastx: Xanthoxin dehydrogenase from Arabidopsis with 67.29% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (AT1G52340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427658.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;