Protein coding transcript 1498

• Transcript: Ll_transcript_425635
• CDS coordinates: 196-1335 (+)
• Peptide sequence: MEKNSNLPQELLEYNILIRLPYKSLVCFKCVCKHWYALFNDPIFLSHHLSYFIKNHNTGHNLLLRLSFPTLFGDGWDNYKLFLLSATDDNYSPVQTLMPKFNMLSTKFQICGHCNGILCLSTEYWSRSKEILLYNPATREFKCLPDSNMRLRPSSVALAVGMGYDIVNDDYKVMRIWRGDMYLFRTNCVEEYSLSTDSWTMLSNTNVGHFIFDADAFAMFFKRTYYWWAFSREDMSWILLALNIEDEVFQRVPLPQNIDISERDDRSLVVWNESISLICCTCDGLTTSIDIWVMDGSGAEGSWTRRRSIKDLMHEAKPLVFWKGNELLMEMSCGKIKSYDVDDGKIEDVVIKGIPNQHSSQAVNYVASTVSLKGGDYLI*
• ORF Type: complete

Annotations of Ll_transcript_425635

• Blastp: F-box/kelch-repeat protein At3g06240 from Arabidopsis with 27.93% of identity
• Blastx: F-box/kelch-repeat protein At3g06240 from Arabidopsis with 27.93% of identity
• Eggnog: FBOX(ENOG410ZSG0)
• Kegg: Link to kegg annotations (AT3G06240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424372.1)
• Pfam: F-box domain (PF00646.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;