Protein coding transcript 149811

• Transcript: Ll_transcript_231626
• CDS coordinates: 211-663 (+)
• Peptide sequence: MDPGELKRIFQLFDRNGDGRITMKELNDSLEKLSIYIPDNELAKMIEKIDVNHDGCVDIDEFGELYKSIMDDRDEEEDMREAFNVFDQNGDGFISVEELRSVLSSLGLKQGRTVEDCKKMIMKVDVDGDGMVDYKEFKQMMKGGGFSALS*
• ORF Type: complete

Annotations of Ll_transcript_231626

• Blastp: Calmodulin-like protein 7 from Arabidopsis with 76.67% of identity
• Blastx: Calmodulin-like protein 7 from Arabidopsis with 76% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT1G05990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001236739.2)
• Pfam: EF hand (PF00036.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;