Protein coding transcript 149830

• Transcript: Ll_transcript_231876
• CDS coordinates: 1038-1523 (+)
• Peptide sequence: MPSWVFIKNKPLIPKVVMLYMPGLDAALFLSQSKRFPNLKKFCRKPRPLLALSRISDSMQTVDALLTCKLKRKRDQHSSIIPKSTLISQQEKGCSDTDGVSFTELVKDIPFPVTYYTLTEKQLEENGYSVNQPGFISTMPAPPGSFCEMLALDCEMVSQFG*
• ORF Type: complete

Annotations of Ll_transcript_231876

• Blastp: Small RNA degrading nuclease 5 from Arabidopsis with 56.96% of identity
• Blastx: Small RNA degrading nuclease 5 from Arabidopsis with 79.17% of identity
• Eggnog: DNA polymerase iii(COG0847)
• Kegg: Link to kegg annotations (AT5G25800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442933.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;