Transcript | Ll_transcript_231881 |
---|---|
CDS coordinates | 518-829 (+) |
Peptide sequence | MMALLTCQKDLTKGKDLKLSASSELKQILGRMDARIHKLYMALPTNAMLIICTGHGDTAVVHRLRRMLAEEGESNFCREQIVEILEELQARAEVALCFVGVKH* |
ORF Type | complete |
Blastp | Small RNA degrading nuclease 5 from Arabidopsis with 58.25% of identity |
---|---|
Blastx | Small RNA degrading nuclease 5 from Arabidopsis with 57.42% of identity |
Eggnog | DNA polymerase iii(COG0847) |
Kegg | Link to kegg annotations (AT5G25800) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442933.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer