Protein coding transcript 149832

• Transcript: Ll_transcript_231881
• CDS coordinates: 518-829 (+)
• Peptide sequence: MMALLTCQKDLTKGKDLKLSASSELKQILGRMDARIHKLYMALPTNAMLIICTGHGDTAVVHRLRRMLAEEGESNFCREQIVEILEELQARAEVALCFVGVKH*
• ORF Type: complete

Annotations of Ll_transcript_231881

• Blastp: Small RNA degrading nuclease 5 from Arabidopsis with 58.25% of identity
• Blastx: Small RNA degrading nuclease 5 from Arabidopsis with 57.42% of identity
• Eggnog: DNA polymerase iii(COG0847)
• Kegg: Link to kegg annotations (AT5G25800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442933.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;