Protein coding transcript 149908

• Transcript: Ll_transcript_230727
• CDS coordinates: 1073-1723 (+)
• Peptide sequence: MIIFYFDVLQPCKILMTYFLFTKVVGTIGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVERNLPRNEQKLLDWVRPYISDTKKFHLIVDPRLEGQYCIQSALKLAALANKCLMKQAKSRPKMSEVVELLGNIINETIPPEEDVSQAVIATGEGKEVNLSVEDTEPKPPKPPRQGNNYLKTVFVFRDIVSLRNKSIRRFDWKSWAPGLIRTW*
• ORF Type: complete

Annotations of Ll_transcript_230727

• Blastp: Probable serine/threonine-protein kinase PBL19 from Arabidopsis with 55.71% of identity
• Blastx: Receptor-like serine/threonine-protein kinase At3g01300 from Arabidopsis with 55.75% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G47070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454070.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;