Protein coding transcript 150011

• Transcript: Ll_transcript_231500
• CDS coordinates: 191-751 (+)
• Peptide sequence: MAVTNDSNRSVRLLFHPKHLHTGSNPSTHWLIGSPFFPPLTIASLLHSSSSDLNKESDQLRSLIPKGFEVIGALASRNGVVDDDARDAIESARGLRKILYGEKDREVVGAVAGSGEVKFFVSESGNVKGFELVTEVIEEENSEKFVWENGCLLRCELPIKLPLYYPVRNQNGRFHFNFILGFEWLW*
• ORF Type: complete

Annotations of Ll_transcript_231500

• Blastp: Probable Ufm1-specific protease from Arabidopsis with 48.26% of identity
• Blastx: Probable Ufm1-specific protease from Arabidopsis with 45.93% of identity
• Eggnog: ufm1-specific peptidase(ENOG410XTJE)
• Kegg: Link to kegg annotations (AT3G48380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414884.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;