Protein coding transcript 150013

• Transcript: Ll_transcript_231503
• CDS coordinates: 1233-2138 (+)
• Peptide sequence: MLPNLLAKHPQLKPYHFNPPGVLHPITVFYELSFGETEMKQVEVRKSLHSRLGLPYDRPLLRIANALDFSKLRNSGNASLQKGPSLPRDVHIGIPSSGVTGGTVSLVQGSYEYFHYLQDGYNDSGWGCAYRSLQTIISWFRLQNYSSIEVPSHREIQQSLVEIGDKDPSFIGSREWIGAIELSFVLDKLLGVTCKVINVRSGSELPEKCRELALHFENQGTPVMIGGGVLAYTLLGVDYNEASGDCAFLILDPHYTGTDDLKKIINGGWCGWKKAVDNKGRNFFLHDKFYNLLLPQRPNMV*
• ORF Type: complete

Annotations of Ll_transcript_231503

• Blastp: Probable Ufm1-specific protease from Arabidopsis with 80.07% of identity
• Blastx: Probable Ufm1-specific protease from Arabidopsis with 67.59% of identity
• Eggnog: ufm1-specific peptidase(ENOG410XTJE)
• Kegg: Link to kegg annotations (AT3G48380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414884.1)
• Pfam: Peptidase family C78 (PF07910.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;