Protein coding transcript 150028

• Transcript: Ll_transcript_231586
• CDS coordinates: 2-424 (+)
• Peptide sequence: SFPSTHVSIIVSLKILRETEKKSETKMEGVKRYAVLMCAEDSDYVRNKHGGYFGVFVRMLAEEGERWDMYKVARGEFPEERELCLYDGFVITGSCNDAHGNDPWVHHLLNLLSKLNSMNKKILGICFGHQVSNNHTHLCN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_231586

• Blastp: Gamma-glutamyl peptidase 5 from Arabidopsis with 52.48% of identity
• Blastx: Gamma-glutamyl peptidase 5 from Arabidopsis with 52.48% of identity
• Eggnog: Catalyzes the synthesis of GMP from XMP (By similarity)(COG0518)
• Kegg: Link to kegg annotations (AT2G23970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418260.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;