Transcript | Ll_transcript_232063 |
---|---|
CDS coordinates | 243-965 (+) |
Peptide sequence | MGNYCGKPVAHVSSNFTGSKNKTVNKPKEDLFTYHQKAALQKSQANVNKSISNNLKSFSFIDLKEATKNFRRENLIGEGGFGYVFKGWIDEITYAPTKPGSGMVVAIKNLKPESFQGHKEWLTEINYLGQLQHENLVKLIGYCLDGKNRLLVYEFMQKGSLENHLFRKGVQPIAWATRISIAIGVARGLAFLHSLNANVIFRDLKASNILLDSVSNTRSGKYYMFWFTCKFHSERVANFL* |
ORF Type | complete |
Blastp | Probable serine/threonine-protein kinase PBL3 from Arabidopsis with 67.07% of identity |
---|---|
Blastx | Probable serine/threonine-protein kinase PBL2 from Arabidopsis with 63.79% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT2G02800) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440607.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer