Protein coding transcript 150133

• Transcript: Ll_transcript_232066
• CDS coordinates: 727-1095 (+)
• Peptide sequence: MAASNKLTGSKNKTVNKPKEDLFTYHQKAALQKSQANVNKSISNNLKSFSFIDLKEATKNFRRENLIGEGGFGYVFKGWIDEITYAPTKPGSGMVVAIKNLKPESFQGHKEWLVCARKKLKS*
• ORF Type: complete

Annotations of Ll_transcript_232066

• Blastp: Probable serine/threonine-protein kinase PBL2 from Arabidopsis with 68.06% of identity
• Blastx: Probable serine/threonine-protein kinase PBL3 from Arabidopsis with 66.67% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G14370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440606.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;