Protein coding transcript 150142

• Transcript: Ll_transcript_232089
• CDS coordinates: 222-617 (+)
• Peptide sequence: MSWQTYVDEHLLCDIEGNQLTSAAIIGQDGSVWAQSSNFPQLKPEEITGIVNDFAEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNLALIIGIYDEPMTPGQCNMVVERLGDYLVDQGL*
• ORF Type: complete

Annotations of Ll_transcript_232089

• Blastp: Profilin-1 from Ricinus with 90.08% of identity
• Blastx: Profilin-1 from Ricinus with 90.08% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (8265128)
• CantataDB: Link to cantataDB annotations (CNT0002491)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446412.1)
• Pfam: Profilin (PF00235.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;