Protein coding transcript 150143

• Transcript: Ll_transcript_232060
• CDS coordinates: 223-534 (+)
• Peptide sequence: MSWQTYVDEHLLCDIEGNQLTSAAIIGQDGSVWAQSTNFPQFKPEEIAAIVNDFAEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKVNSVPRLCLTFEYVNV*
• ORF Type: complete

Annotations of Ll_transcript_232060

• Blastp: Profilin-1 from Soja with 90.8% of identity
• Blastx: Profilin-1 from Soja with 90.8% of identity
• Eggnog: Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations (By(ENOG41126PD)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002491)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431556.1)
• Pfam: Profilin (PF00235.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;