Transcript | Ll_transcript_232070 |
---|---|
CDS coordinates | 189-584 (+) |
Peptide sequence | MSWQTYVDEHLLCDIEGNQLTSAAIIGQDGSVWAQSSNFPQLKPEEITGIVNDFAEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNLALIIGIYDEPMTPGQCNMVVERLGDYLVDQGL* |
ORF Type | complete |
Blastp | Profilin-1 from Ricinus with 90.08% of identity |
---|---|
Blastx | Profilin from Cucumis with 87.02% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (8265128) |
CantataDB | Link to cantataDB annotations (CNT0002491) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446412.1) |
Pfam | Profilin (PF00235.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer