Protein coding transcript 150162

• Transcript: Ll_transcript_231386
• CDS coordinates: 1-1176 (+)
• Peptide sequence: QKQFLHFITKRSKMCGGAIISDFISAGGAPAKSRILTADYLWPDLKKSGSEKSKKKKVLIDLDDDFEADFRDFNEESEVDDDDDDVFMMDSKKKPCALKSAKSYTSISHGSTAEKPAVFEAQQQADKSVKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFRTAEEAARAYDAEARRIRGRKAKVNFPDEALDASPKCSKANPQGKMNTVQPNGNLSQKFNVVGSNQDNFYTSMDLVEQKPMVIQYANMGSFPRRGHENNSLASSDDLTRYFSSDQGSNSFDYSDLPEISSMLSAPLEGESHFMQYANQQQNIPHSNSQDASAKSLSDELAEIESELNFFKMPYFEGSWSDASFESLLAGDTTQYGGNLMNLWSFDDINMGGGGVL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_231386

• Blastp: Ethylene-responsive transcription factor RAP2-2 from Arabidopsis with 43.24% of identity
• Blastx: Ethylene-responsive transcription factor RAP2-2 from Arabidopsis with 42.59% of identity
• Eggnog: Transcription factor(ENOG410YERP)
• Kegg: Link to kegg annotations (AT3G14230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423543.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;