Protein coding transcript 1502

• Transcript: Ll_transcript_425651
• CDS coordinates: 2-1135 (+)
• Peptide sequence: THERKHKMTHVNHLTWAFPCSVFHPHHPETGFKPQNFNPLIHVPISSVTLKDTTKPLSFTVSSVDTKQNTVTVEESETITTFNFDAYMLEKADIINKALDASIALKEPLTIQEPMRYSLLAGGKRVRPMLCIAACELVGGSQEMGIPAACAVEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVFGVDVAVLAGDSLLALAFEHVAAATKGVSPDRVVRAIAELAKSVGSEGLVAGQVMDIQSEGLSVSEVKLERLEFIHIHKTAVLLEAAVVAGAIMGGGTDEEIERLRKYARCIGLLFQVVDDILDITKSSQELGKTAGKDLVTDKVTYPKLLGIQESKDFAAKLMRDAHEHLSAFDLDKAAPLYALANYIAYREN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_425651

• Blastp: Geranylgeranyl pyrophosphate synthase, chloroplastic from Hevea with 69.3% of identity
• Blastx: Geranylgeranyl pyrophosphate synthase, chloroplastic from Hevea with 69.3% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444745.1)
• Pfam: Polyprenyl synthetase (PF00348.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;