Transcript | Ll_transcript_425674 |
---|---|
CDS coordinates | 3-500 (+) |
Peptide sequence | LFGGLVGGPDENDDFSDERSNYEQTEPTTSGSAPLIGIFAKLQSLYGNTGSYQYHKESLVSKPTSTNLHQTPTHKTLGGPPVEFLHSITSSWTVSKSTYYRHKVVIKNISQKPITDLKLVIDNLSGTLWGLTPTKEKNTYELPQWLKVLEPGTECTFVYVQGGPQA |
ORF Type | internal |
Blastp | Endoglucanase 5 from Arabidopsis with 55.95% of identity |
---|---|
Blastx | Endoglucanase 5 from Arabidopsis with 55.95% of identity |
Eggnog | hydrolase family(ENOG410XPC9) |
Kegg | Link to kegg annotations (AT1G48930) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441110.1) |
Pfam | Glycosyl hydrolase family 9 (PF00759.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer