Protein coding transcript 150320

• Transcript: Ll_transcript_231809
• CDS coordinates: 3-674 (+)
• Peptide sequence: TKYAHFIPLAHPYTAKDVAEIFVQEVVKLHGFPSTIVSDRDRIFLSTFWSELFKLAGTKLKFSSAYHPQTDGQTEVVNRCLETYLRCITRQKPKKWPNWIGWAEFWYNTNYHSSIKSTPFEALYGRKPPVVIRGDVGMTALDEVARLTVDRNVWLEELKAQLAKAQNLMRQQANKKRRDIEFEVGDMVYLKIQPYKLKNLAKRTNQKLSPRYYGPYAVITKINP
• ORF Type: internal

Annotations of Ll_transcript_231809

• Blastp: Transposon Tf2-9 polyprotein from Schizosaccharomyces with 31.58% of identity
• Blastx: Transposon Tf2-9 polyprotein from Schizosaccharomyces with 31.58% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC167.08)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015964281.2)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;