Protein coding transcript 1504

• Transcript: Ll_transcript_425600
• CDS coordinates: 3-332 (+)
• Peptide sequence: GWSGGSYGCGSRIKLAYTRKIIDAIHSGSLLNAKYKKSEIFGLEIPTEVEGVPSEILDPVNTWSDKKLYKETLLKLAGLFKNNFETFTNYKIGKDNKLTEEILAAGPIF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_425600

• Blastp: Phosphoenolpyruvate carboxykinase (ATP) from Arabidopsis with 81.65% of identity
• Blastx: Phosphoenolpyruvate carboxykinase (ATP) from Arabidopsis with 81.65% of identity
• Eggnog: Phosphoenolpyruvate Carboxylase(COG1866)
• Kegg: Link to kegg annotations (AT4G37870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447310.1)
• Pfam: Phosphoenolpyruvate carboxykinase (PF01293.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;