Protein coding transcript 150517

• Transcript: Ll_transcript_231889
• CDS coordinates: 2-373 (+)
• Peptide sequence: EKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLEESEDEKKKQEELKGKFDGLCKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTME
• ORF Type: internal

Annotations of Ll_transcript_231889

• Blastp: Heat shock protein 81-2 from Oryza sativa with 95.93% of identity
• Blastx: Heat shock protein 81-3 from Oryza sativa with 95.93% of identity
• Eggnog: Molecular chaperone. Has ATPase activity (By similarity)(COG0326)
• Kegg: Link to kegg annotations (4347402)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016165901.1)
• Pfam: Hsp90 protein (PF00183.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;