Transcript | Ll_transcript_231891 |
---|---|
CDS coordinates | 1240-1935 (+) |
Peptide sequence | MMDAGLLNEVYAIYNLEADYTRGLRQAIGVREFEPLLKTCVVEDIYKKEKELTGSSTEKGETLLDSNLREWLISSSDSKSIILLEEAIEKVKVNTRRLVRRQKRMLNRLQTLFGWNIHYVDSTESISRKSEEVWAGQVVESAMKIIRSFLSENESLTSTVELSNMTGMKIIQRDLWTRYICNACGDRVLRGSHEWEQHKQGRGHRKRVSSLNRKARGLTFVEQKLEYSECN* |
ORF Type | complete |
Blastp | tRNA dimethylallyltransferase 2 from Arabidopsis with 51.95% of identity |
---|---|
Blastx | tRNA dimethylallyltransferase 2 from Arabidopsis with 52.03% of identity |
Eggnog | Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A) (By similarity)(COG0324) |
Kegg | Link to kegg annotations (AT2G27760) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448813.1) |
Pfam | IPP transferase (PF01715.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer