Transcript | Ll_transcript_230986 |
---|---|
CDS coordinates | 2-907 (+) |
Peptide sequence | ALQNRSLKSMNLDIHYSIPKGNAPDKDIGHGSLMISGLDSSVLNDELKNIFGFYGDIKGIFDSPEMDHIKFVEFYDVRAAEASLHGLNKIFIAGKQIKIEPFHPKIAACLLQQSQKGQDEPDIGHNLNGNLLVRQKATLSSGAASGGILENGYNQGFQSATELPLNAYIDNNTLFPANSSIHKTARGASTGKSFGICESSSTVDAMKFASIPRFHPHSLPEYHGSLPNGSPYNFSSTISNMAPNIGTGSPEVSGSMHIQGMGSTGNIAEFIARGKYNMLRKFHVLVTYFLTLNGINHILAI* |
ORF Type | 5prime_partial |
Blastp | Protein MEI2-like 2 from Oryza sativa with 53.66% of identity |
---|---|
Blastx | Protein MEI2-like 2 from Oryza sativa with 53.66% of identity |
Eggnog | Rna-binding protein(ENOG4111R9F) |
Kegg | Link to kegg annotations (4330544) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414899.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF13893.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer