Transcript | Ll_transcript_231316 |
---|---|
CDS coordinates | 362-889 (+) |
Peptide sequence | MDNTISCFFLEPFFIAVTVTALCFFLFLFSFLRSSSSLSLNKKHCNCACSCNGAVLNSDSSSLPYLNGGTGVEMLELSPAPVVLSERRTGSSMMEELVPEITTHALSYLDYPSLCRLSMTNSLMRKAANDDNAWKALYHKGQGGIICLGRTFDDEVKWTWYIGASTCLISPHMSK* |
ORF Type | complete |
Blastp | F-box protein SKIP8 from Arabidopsis with 55.56% of identity |
---|---|
Blastx | F-box protein SKIP8 from Arabidopsis with 56.99% of identity |
Eggnog | F-box protein(ENOG410YEVR) |
Kegg | Link to kegg annotations (AT4G10925) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446494.1) |
Pfam | F-box domain (PF00646.32) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer