Protein coding transcript 150601

• Transcript: Ll_transcript_231316
• CDS coordinates: 362-889 (+)
• Peptide sequence: MDNTISCFFLEPFFIAVTVTALCFFLFLFSFLRSSSSLSLNKKHCNCACSCNGAVLNSDSSSLPYLNGGTGVEMLELSPAPVVLSERRTGSSMMEELVPEITTHALSYLDYPSLCRLSMTNSLMRKAANDDNAWKALYHKGQGGIICLGRTFDDEVKWTWYIGASTCLISPHMSK*
• ORF Type: complete

Annotations of Ll_transcript_231316

• Blastp: F-box protein SKIP8 from Arabidopsis with 55.56% of identity
• Blastx: F-box protein SKIP8 from Arabidopsis with 56.99% of identity
• Eggnog: F-box protein(ENOG410YEVR)
• Kegg: Link to kegg annotations (AT4G10925)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446494.1)
• Pfam: F-box domain (PF00646.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;