Protein coding transcript 150708

• Transcript: Ll_transcript_230642
• CDS coordinates: 233-667 (+)
• Peptide sequence: MLSFRKVSFFTDKKEFQRSATALGYVAHAVSLIASYLQVPLRYPLRLGGSHSYIIDNAPSIESTSSDASSSALSFTNGKHIEFPLFLEGQDTTRAAYAVFLLNKDLEQLLNFIGAKSLGPRHVLANLRELSRIIQSSAFIDNLI*
• ORF Type: complete

Annotations of Ll_transcript_230642

• Blastp: UV radiation resistance-associated gene protein from Homo with 40.37% of identity
• Blastx: UV radiation resistance-associated gene protein from Homo with 39.45% of identity
• Eggnog: UV radiation resistance(ENOG410YZ0H)
• Kegg: Link to kegg annotations (7405)
• CantataDB: Link to cantataDB annotations (CNT0002034)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464649.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;