| Transcript | Ll_transcript_230648 |
|---|---|
| CDS coordinates | 548-850 (+) |
| Peptide sequence | MTLDLIIFEIYFTRLIFLQAVSLIASYLQVPLRYPLRLGGSHSYIIDNAPSIESTSSDASSSALSFTNGKHIEFPLFLEGQDTTRAAYAVFLLNKVCHFI* |
| ORF Type | complete |
| Blastp | UV radiation resistance associated protein from Mus with 40% of identity |
|---|---|
| Blastx | - |
| Eggnog | UV radiation resistance(ENOG410YZ0H) |
| Kegg | Link to kegg annotations (78610) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_013446630.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer